PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID RrC9027_p1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family GATA
Protein Properties Length: 228aa    MW: 25264.5 Da    PI: 10.5294
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
RrC9027_p1genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA56.63.6e-18160194135
        GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                 C++C +tkTp+WR+gp g+ktLCnaCG+++r+ +l
  RrC9027_p1 160 CTHCEATKTPQWREGPCGPKTLCNACGVRFRSGRL 194
                 *******************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004012.5E-15154204IPR000679Zinc finger, GATA-type
PROSITE profilePS5011411.345158190IPR000679Zinc finger, GATA-type
SuperFamilySSF577162.57E-14158217No hitNo description
Gene3DG3DSA:3.30.50.105.7E-14158191IPR013088Zinc finger, NHR/GATA-type
CDDcd002025.57E-13160196No hitNo description
PfamPF003207.0E-16160194IPR000679Zinc finger, GATA-type
PROSITE patternPS003440160185IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 228 aa     Download sequence    Send to blast
DVLTSFSSQF TTSHGRASKG VQRKKPVPTL KQSSSSEVSS TIDSCLYDVK VSTLFQSSNA  60
VSVLENGSVS FQNPIQRLAF PVKGTRSKLR KRPTPPTFRS LKSFASEMVQ QFASPDYDSG  120
SETYHLPSDN APKKKRQKKN NKSDSDTPEA FNADGTIRMC THCEATKTPQ WREGPCGPKT  180
LCNACGVRFR SGRLLPEYRP SSSPSFIPSL HSNSHRKIIE MRMKDKPG
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1131138PKKKRQKK
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013636763.12e-89PREDICTED: putative GATA transcription factor 13
RefseqXP_013636764.12e-89PREDICTED: putative GATA transcription factor 13
RefseqXP_013636765.12e-89PREDICTED: putative GATA transcription factor 13
RefseqXP_013636766.12e-89PREDICTED: putative GATA transcription factor 13
RefseqXP_013744139.12e-89PREDICTED: putative GATA transcription factor 13 isoform X1
RefseqXP_013744140.12e-89PREDICTED: putative GATA transcription factor 13 isoform X2
RefseqXP_013744141.12e-89PREDICTED: putative GATA transcription factor 13 isoform X2
RefseqXP_013744142.12e-89PREDICTED: putative GATA transcription factor 13 isoform X1
SwissprotQ6DBP86e-67GAT11_ARATH; GATA transcription factor 11
TrEMBLA0A078K3U32e-89A0A078K3U3_BRANA; BnaCnng77580D protein
TrEMBLA0A0D3C2J32e-89A0A0D3C2J3_BRAOL; Uncharacterized protein
STRINGBra035708.1-P2e-83(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM16812589
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G08010.21e-49GATA transcription factor 11